Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4

Product Specifications

CAS Number

141758-74-9

Synonyms

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPP

Molecular Formula

C184H282N50O60S1

Molecular Weight

4,186.03 g/mol

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human KLB/Beta-klotho Monoclonal Antibody (1A138)
MBS1579560-01 0.05 mg

Anti-Human KLB/Beta-klotho Monoclonal Antibody (1A138)

Sign In for Pricing
View Details
Anti-Human KLB/Beta-klotho Monoclonal Antibody (1A138)
MBS1579560-02 0.1 mg

Anti-Human KLB/Beta-klotho Monoclonal Antibody (1A138)

Sign In for Pricing
View Details
Anti-Human KLB/Beta-klotho Monoclonal Antibody (1A138)
MBS1579560-03 5x 0.1 mg

Anti-Human KLB/Beta-klotho Monoclonal Antibody (1A138)

Sign In for Pricing
View Details
Tpsb2 (NM_019180) Rat Tagged Lenti ORF Clone
RR206867L3 10 µg

Tpsb2 (NM_019180) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CXCL10 antibody
70R-36229 100 ug

CXCL10 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HIST1H2AB [ubiquitylated Lys119] Antibody
NBP3-15563-100ul 100 µL

Rabbit Polyclonal HIST1H2AB [ubiquitylated Lys119] Antibody

Sign In for Pricing
View Details