Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Defensin-3 (Human)

Product Specifications

Synonyms

HBD-3; Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly- Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly- Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys; DEFB3; GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKC

Molecular Formula

C216H371N75O59S6

Molecular Weight

5,155.1 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-2019-nCoV (N) IgG ELISA Kit
orb1293112-01 48 Tests

Human anti-2019-nCoV (N) IgG ELISA Kit

Sign In for Pricing
View Details
Human anti-2019-nCoV (N) IgG ELISA Kit
orb1293112-02 96 Tests

Human anti-2019-nCoV (N) IgG ELISA Kit

Sign In for Pricing
View Details
C4d Complement (C4d Complement fragment, Acidic Complement C4, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 2)
253956 100 µL

C4d Complement (C4d Complement fragment, Acidic Complement C4, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 2)

Sign In for Pricing
View Details
Human CD39 full length protein-synthetic nanodisc
orb1743206-01 10 µg

Human CD39 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CD39 full length protein-synthetic nanodisc
orb1743206-02 50 µg

Human CD39 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human CD39 full length protein-synthetic nanodisc
orb1743206-03 100 µg

Human CD39 full length protein-synthetic nanodisc

Sign In for Pricing
View Details