β-Defensin-3 (Human)
Product Specifications
Synonyms
HBD-3; Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly- Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly- Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys; DEFB3; GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKC
Molecular Formula
C216H371N75O59S6
Molecular Weight
5,155.1 g/mol
Shipping Conditions
Cool Pack
Controlled
No
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SGC74324-01 50 mg
6-[ (tert-Butoxy) carbonyl]-6-azaspiro[2.5]octane-5-carboxylic acid
Sign In for Pricing
View Details SGC74324-02 0.5 g
6-[ (tert-Butoxy) carbonyl]-6-azaspiro[2.5]octane-5-carboxylic acid
Sign In for Pricing
View Details 
MBS2153097-01 25 Tests
FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
Sign In for Pricing
View Details MBS2153097-02 50 Tests
FITC-Linked Anti-Fc Fragment Of IgG Low Affinity IIIb Receptor (FcgR3B) Monoclonal Antibody
Sign In for Pricing
View Details