Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-38)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C184H277N51O56S

Molecular Weight

4,131.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNIP2 Protein Vector (Rat) (pPM-C-His)
PV275749 500 ng

KCNIP2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ADAM2 (ADAM Metallopeptidase Domain 2, CRYN1, CRYN2, FTNB, PH-30b, PH30) (MaxLight 405)
MBS6194392-01 0.1 mL

ADAM2 (ADAM Metallopeptidase Domain 2, CRYN1, CRYN2, FTNB, PH-30b, PH30) (MaxLight 405)

Sign In for Pricing
View Details
ADAM2 (ADAM Metallopeptidase Domain 2, CRYN1, CRYN2, FTNB, PH-30b, PH30) (MaxLight 405)
MBS6194392-02 5x 0.1 mL

ADAM2 (ADAM Metallopeptidase Domain 2, CRYN1, CRYN2, FTNB, PH-30b, PH30) (MaxLight 405)

Sign In for Pricing
View Details
INHBC Antibody - middle region
OASG03872-100UL 100 µL

INHBC Antibody - middle region

Sign In for Pricing
View Details
Porcine Sex Determining Region Y Box Protein 2 ELISA Kit
MBS752422-01 48 Well

Porcine Sex Determining Region Y Box Protein 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Sex Determining Region Y Box Protein 2 ELISA Kit
MBS752422-02 96 Well

Porcine Sex Determining Region Y Box Protein 2 ELISA Kit

Sign In for Pricing
View Details