Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-38)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C184H277N51O56S

Molecular Weight

4,131.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza B Antibody
OASB02232-500UG 0.5 mg

Influenza B Antibody

Sign In for Pricing
View Details
Human Protein FAM206A, FAM206A ELISA KIT
ELI-20599h 96 Tests

Human Protein FAM206A, FAM206A ELISA KIT

Sign In for Pricing
View Details
Histone H4, hyperacetylated
H5110-15B 200 µg

Histone H4, hyperacetylated

Sign In for Pricing
View Details
EIF2B4 Peptide - middle region (AAP78626)
AAP78626-100UG 100 µg

EIF2B4 Peptide - middle region (AAP78626)

Sign In for Pricing
View Details
Rabbit anti-ART5 Antibody
MBS4510637-01 0.05 mL

Rabbit anti-ART5 Antibody

Sign In for Pricing
View Details
Rabbit anti-ART5 Antibody
MBS4510637-02 0.1 mL

Rabbit anti-ART5 Antibody

Sign In for Pricing
View Details