Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β- Amyloid (1-38)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C184H277N51O56S

Molecular Weight

4,131.63 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)
MBS7028670-01 0.02 mg

Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)
MBS7028670-02 0.1 mg

Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)
MBS7028670-03 5x 0.1 mg

Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)

Sign In for Pricing
View Details
COPS8 Antibody
DF8239-01 100 µL

COPS8 Antibody

Sign In for Pricing
View Details
COPS8 Antibody
DF8239-02 200 µL

COPS8 Antibody

Sign In for Pricing
View Details
Cystatin SA CRISPR/Cas9 KO Plasmid (h)
sc-406907 20 µg

Cystatin SA CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details