Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-39)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C81H128N32O19S2

Molecular Weight

1,918.3 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CISD2 Rabbit Polyclonal Antibody
TA374813 100 µL

CISD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Deoxy-2-chloro-D-glucose
TRC-D232570-10MG 10 mg

2-Deoxy-2-chloro-D-glucose

Sign In for Pricing
View Details
HRP conjugated Anti-His Antibody (AY63), mAb
HIS-PLM535-1mg 1 mg

HRP conjugated Anti-His Antibody (AY63), mAb

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS802159 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]
TA800911BM 100 µL

CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A5]

Sign In for Pricing
View Details
katanin p80 (KATNB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A1]
TA503724BM 100 µL

katanin p80 (KATNB1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A1]

Sign In for Pricing
View Details