Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-39)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C81H128N32O19S2

Molecular Weight

1,918.3 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCFL5 Antibody
8C11878-AAT 50 µg

TCFL5 Antibody

Sign In for Pricing
View Details
MTT Cell Viability Assay Kit (1000 Assays)
#30006 1 Kit

MTT Cell Viability Assay Kit (1000 Assays)

Sign In for Pricing
View Details
Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
RD-GDNF-Ra-01 96 Tests

Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details
Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
RD-GDNF-Ra-02 48 Tests

Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details
N-Acetyl-DL-cysteine
TRC-A172140-5G 5 g

N-Acetyl-DL-cysteine

Sign In for Pricing
View Details
Nogo A (RTN4) (NM_207520) Human Recombinant Protein
TP320981 20 µg

Nogo A (RTN4) (NM_207520) Human Recombinant Protein

Sign In for Pricing
View Details