Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-39)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C81H128N32O19S2

Molecular Weight

1,918.3 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE3A (NM_000921) Human Over-expression Lysate
LY424434 100 µg

PDE3A (NM_000921) Human Over-expression Lysate

Sign In for Pricing
View Details
FYCO1 Mouse Monoclonal Antibody [Clone ID: OTI8G7]
CF809860 100 µg

FYCO1 Mouse Monoclonal Antibody [Clone ID: OTI8G7]

Sign In for Pricing
View Details
3-(7-Cyano-5-(2-nitropropyl)indolin-1-yl)propyl Benzoate
TRC-C982035-25G 25 g

3-(7-Cyano-5-(2-nitropropyl)indolin-1-yl)propyl Benzoate

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP1) (rRBP1/872), CF647 conjugate, 0.1mg/mL
BNC473603-500 1x 500 µL

Retinol Binding Protein-1 (RBP1) (rRBP1/872), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®740 Donkey Anti-Goat IgG (H+L), highly Crossed-Adsorbed, 2 mg/mL
#20987-50uL 1x 50 µL

CF®740 Donkey Anti-Goat IgG (H+L), highly Crossed-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
1700012P22Rik Mouse Gene Knockout Kit (CRISPR)
KN500085 1 Kit

1700012P22Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details