Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-39)

Product Specifications

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG

Molecular Formula

C81H128N32O19S2

Molecular Weight

1,918.3 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-43 + DC10), CF568 conjugate, 0.1mg/mL
BNC680770-100 1x 100 µL

Cytokeratin 8/18 (C-43 + DC10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human BTBD1 activation kit by CRISPRa
GA110000 1 Kit

Human BTBD1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Amino-2-(4-hexylphenethyl)propane-1,3-diol hydrochloride
TRC-A399650-500MG 500 mg

2-Amino-2-(4-hexylphenethyl)propane-1,3-diol hydrochloride

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (rTYMS/1884), Biotin conjugate, 0.1mg/mL
BNCB3812-100 1x 100 µL

Thymidylate Synthase (5-FU Resistance Marker) (rTYMS/1884), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P-Phenylenediamine Dihydrochloride
TRC-P399618-500MG 500 mg

P-Phenylenediamine Dihydrochloride

Sign In for Pricing
View Details
ApoA1 Antibody
KC-8298-01 50 μL

ApoA1 Antibody

Sign In for Pricing
View Details