What is the catalog number for β-Amyloid (1-42), human?

The catalog number for β-Amyloid (1-42), human is PA17130.

What sizes are available for β-Amyloid (1-42), human?

β-Amyloid (1-42), human is available in the following size(s): 1 mg, 10 mg, 100 mg.

How many pack sizes does β-Amyloid (1-42), human come in?

β-Amyloid (1-42), human is available in 3 different pack sizes.

Is β-Amyloid (1-42), human in stock?

β-Amyloid (1-42), human is currently made to order / not held in immediate stock. Contact us for lead time.

β-Amyloid (1-42), human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.1 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N0761S 0.5 µmol

3'-Desthiobiotin-GTP

Sign In for Pricing

View Details

bs-3396R-BF488-TR 20 µL

Phospho-SGK1 (Ser422) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing

View Details

HP517014-01 50 µg

Anti-DNM3 Polyclonal Antibody

Sign In for Pricing

View Details

HP517014-02 100 µg

Anti-DNM3 Polyclonal Antibody

Sign In for Pricing

View Details

orb3126758 100 µL

CD19 Recombinant Rabbit mAb, HRP conjugated

Sign In for Pricing

View Details

MR226062L3 10 µg

Eif5a (NM_001166591) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

View Details