What is the catalog number for β-Amyloid (1-42), human?

The catalog number for β-Amyloid (1-42), human is PA17130.

What sizes are available for β-Amyloid (1-42), human?

β-Amyloid (1-42), human is available in the following size(s): 1 mg, 10 mg, 100 mg.

How many pack sizes does β-Amyloid (1-42), human come in?

β-Amyloid (1-42), human is available in 3 different pack sizes.

Is β-Amyloid (1-42), human in stock?

β-Amyloid (1-42), human is currently made to order / not held in immediate stock. Contact us for lead time.

β-Amyloid (1-42), human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.1 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-425413-ACT 20 µg

ISG20 CRISPR Activation Plasmid (m)

Sign In for Pricing

View Details

MBS7212356-01 48 Well

Bovine Retinoic acid receptor RXR-gamma (RXRG) ELISA Kit

Sign In for Pricing

View Details

MBS7212356-02 96 Well

Bovine Retinoic acid receptor RXR-gamma (RXRG) ELISA Kit

Sign In for Pricing

View Details

MBS7212356-03 5x 96 Well

Bovine Retinoic acid receptor RXR-gamma (RXRG) ELISA Kit

Sign In for Pricing

View Details

MBS7212356-04 10x 96 Well

Bovine Retinoic acid receptor RXR-gamma (RXRG) ELISA Kit

Sign In for Pricing

View Details

MBS109141-01 48 Well

Qualitative Human Listeria Antibody IgM (LST-IgM) ELISA Kit

Sign In for Pricing

View Details