What is the catalog number for β-Amyloid (1-42), human?

The catalog number for β-Amyloid (1-42), human is PA17130.

What sizes are available for β-Amyloid (1-42), human?

β-Amyloid (1-42), human is available in the following size(s): 1 mg, 10 mg, 100 mg.

How many pack sizes does β-Amyloid (1-42), human come in?

β-Amyloid (1-42), human is available in 3 different pack sizes.

Is β-Amyloid (1-42), human in stock?

β-Amyloid (1-42), human is currently made to order / not held in immediate stock. Contact us for lead time.

β-Amyloid (1-42), human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.1 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx171726 1 mL

Cholinergic Receptor, Nicotinic, Alpha 1 (CHRNa1) Antibody

Sign In for Pricing

View Details

PV005357 500 ng

C18orf21 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing

View Details

STJ97009 200 µl

Anti-CD25 antibody

Sign In for Pricing

View Details

M3519-27 1 g

1-Methyl-nicotinamide Methosulphate

Sign In for Pricing

View Details

HY-Z0465-01 250 mg

Methyl 2-tert-Butyloxycarbonylaminoacrylate

Sign In for Pricing

View Details

HY-Z0465-02 500 mg

Methyl 2-tert-Butyloxycarbonylaminoacrylate

Sign In for Pricing

View Details