What is the catalog number for β-Amyloid (1-42), human?

The catalog number for β-Amyloid (1-42), human is PA17130.

What sizes are available for β-Amyloid (1-42), human?

β-Amyloid (1-42), human is available in the following size(s): 1 mg, 10 mg, 100 mg.

How many pack sizes does β-Amyloid (1-42), human come in?

β-Amyloid (1-42), human is available in 3 different pack sizes.

Is β-Amyloid (1-42), human in stock?

β-Amyloid (1-42), human is currently made to order / not held in immediate stock. Contact us for lead time.

β-Amyloid (1-42), human

Product Specifications

CAS Number

107761-42-2

Synonyms

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH

Molecular Formula

C203H311N55O60S

Molecular Weight

4,514.1 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR15121058 1 Vial

Lentiviral human PTGR1 shRNA (UAS) - Lentiviral human PTGR1 shRNA (UAS, iRFP) (25)

Sign In for Pricing

View Details

PPL01525-2a 1 Each

PGL4.19-TA-RORE response element

Sign In for Pricing

View Details

MBS7049442-01 0.05 mg

LASP1 Antibody, FITC conjugated

Sign In for Pricing

View Details

MBS7049442-02 0.1 mg

LASP1 Antibody, FITC conjugated

Sign In for Pricing

View Details

MBS7049442-03 5x 0.1 mg

LASP1 Antibody, FITC conjugated

Sign In for Pricing

View Details

SI014096A 1 Each

Human RRBP1 Pre-designed siRNA Set A

Sign In for Pricing

View Details