Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1 Toxin

Product Specifications

Synonyms

GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2; H-Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr- Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Gl u-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-A

Molecular Formula

C308H466N90O95S8

Molecular Weight

7,206.21 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xpress™ Human NUBP2 Over-expressing Stable Cell Line
ABC-X2102 1 Vial

Xpress™ Human NUBP2 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
BEND2 (Xp22) gene break apart probe reagent (C11ORF95 (ZFTA) )
FP-280 1 Vial 100 μL (10-20 T)

BEND2 (Xp22) gene break apart probe reagent (C11ORF95 (ZFTA) )

Sign In for Pricing
View Details
MAPKAPK2 antibody (Ser272)
70R-34528 0.1 mg

MAPKAPK2 antibody (Ser272)

Sign In for Pricing
View Details
Anti-human Fibrinogen, Matched Pair Antibodies for EIA
5D-18132 5 Plates

Anti-human Fibrinogen, Matched Pair Antibodies for EIA

Sign In for Pricing
View Details
Cornulin Polyclonal Antibody, Cy5.5 Conjugated
bs-5833R-Cy5.5 100 µL

Cornulin Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
LOC255766 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
TL318168V 500 µL Each

LOC255766 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Sign In for Pricing
View Details