Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Keratinocyte differentiation-associated protein (Krtdap)

Product Specifications

Abbreviation

Recombinant Rat Krtdap protein

Gene Name

Krtdap

UniProt

P85411

Expression Region

23-98aa

Organism

Rattus norvegicus (Rat)

Target Sequence

AALGTPMEDTTSSNYPSGTEGLSEFLNFNKLQSAFKSDDFLNWHVLTDMFKKALPFINWEFFPKVKGLRSAVPDSQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May act as a soluble regulator of keratinocyte differentiation . May play an important role in embryonic skin morphogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

References & Citations

"Kdap, a novel gene associated with the stratification of the epithelium." Oomizu S., Sahuc F., Asahina K., Inamatsu M., Matsuzaki T., Sasaki M., Obara M., Yoshizato K. Gene 256:19-27 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL
BNC680779-100 1x 100 µL

CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL
BNC042197-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL
BNC941688-100 1x 100 µL

CD79a (IGA/1688R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details