Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESM-1, Human (HEK293, His)

ESM-1 (Endocan) serves a vital role in angiogenesis by promoting new blood vessel sprouting. Its implication in lung endothelial cell-leukocyte interactions suggests potential significance in regulating immune responses within the pulmonary vasculature. ESM-1 Protein, Human (HEK293, His) is the recombinant human-derived ESM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ESM-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/esm-1-protein-human-hek-293-his.html

Purity

96.0

Smiles

WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Molecular Formula

11082 (Gene_ID) Q9NQ30-1/AAH11989.1 (W20-R184) (Accession)

Molecular Weight

Approximately 20-27 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ckm (Creatine kinase M-type) QuickTest ELISA Kit
QT-ER0308 96 Tests

Rat Ckm (Creatine kinase M-type) QuickTest ELISA Kit

Sign In for Pricing
View Details
Leukocyte RNA Purification Kit
10760064-1 50 Preparations

Leukocyte RNA Purification Kit

Sign In for Pricing
View Details
Mouse Tacstd2 Antibody
abx030948-01 80 µL

Mouse Tacstd2 Antibody

Sign In for Pricing
View Details
Mouse Tacstd2 Antibody
abx030948-02 400 µL

Mouse Tacstd2 Antibody

Sign In for Pricing
View Details
Hydroxy Ethyl Cellulose HV 145 mPas
114815 500 g

Hydroxy Ethyl Cellulose HV 145 mPas

Sign In for Pricing
View Details
Lentiviral human NKX2-5 shRNA (UAS) - Lentiviral human NKX2-5 shRNA (UAS) (100)
GTR15314649 1 Vial

Lentiviral human NKX2-5 shRNA (UAS) - Lentiviral human NKX2-5 shRNA (UAS) (100)

Sign In for Pricing
View Details