Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mesothelin, Mouse (HEK293, His)

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Mesothelin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mesothelin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Molecular Formula

56047 (Gene_ID) Q61468 (D298-S600) (Accession)

Molecular Weight

38-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

stabilin1 (STAB1) Human siRNA Oligo Duplex (Locus ID 23166)
SR308055 1 Kit

stabilin1 (STAB1) Human siRNA Oligo Duplex (Locus ID 23166)

Ask
View Details
RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (Biotin)
MBS6144175-01 0.1 mL

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (Biotin)

Ask
View Details
RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (Biotin)
MBS6144175-02 5x 0.1 mL

RUFY1 (RUN and FYVE Domain-containing Protein 1, FYVE-finger Protein EIP1, La-binding Protein 1, Rab4-interacting Protein, RABIP4, Zinc Finger FYVE Domain-containing Protein 12, ZFYVE12) (Biotin)

Ask
View Details
Anti-p90RSK Rabbit Monoclonal Antibody
M01058-5-40μl 40 µL

Anti-p90RSK Rabbit Monoclonal Antibody

Ask
View Details
Lentiviral mouse Cd209b shRNA (UAS) - Lentiviral mouse Cd209b shRNA (UAS) plasmid
GTR15149671 1 Vial

Lentiviral mouse Cd209b shRNA (UAS) - Lentiviral mouse Cd209b shRNA (UAS) plasmid

Ask
View Details
Recombinant Human MYT1, N-His
MBS1574430-01 0.1 mg

Recombinant Human MYT1, N-His

Ask
View Details