Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mesothelin, Mouse (HEK293, His)

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Mesothelin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mesothelin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Molecular Formula

56047 (Gene_ID) Q61468 (D298-S600) (Accession)

Molecular Weight

38-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BACE2, ID (Beta-secretase 2, Beta-site Amyloid Precursor Protein Cleaving Enzyme 2, Beta-site APP Cleaving Enzyme 2, Aspartyl Protease 1, Asp 1, ASP1, Membrane-associated Aspartic Protease 1, Memapsin-1, Aspartic-like Protease 56kD, Down Region Aspartic Protease, DRAP, Theta-secretase, AEPLC, ALP56, ASP21, CDA13, UNQ418/PRO852)
B0002-92E9 200 µL

BACE2, ID (Beta-secretase 2, Beta-site Amyloid Precursor Protein Cleaving Enzyme 2, Beta-site APP Cleaving Enzyme 2, Aspartyl Protease 1, Asp 1, ASP1, Membrane-associated Aspartic Protease 1, Memapsin-1, Aspartic-like Protease 56kD, Down Region Aspartic Protease, DRAP, Theta-secretase, AEPLC, ALP56, ASP21, CDA13, UNQ418/PRO852)

Ask
View Details
Elastin (ELN) (HRP) discontinued
E2230-08-HRP 100 µL

Elastin (ELN) (HRP) discontinued

Ask
View Details
Lectin from lentils conjugated with Sepharose
L0133 25 mL

Lectin from lentils conjugated with Sepharose

Ask
View Details
RPL3 (60S Ribosomal Protein L3, L3, ASC-1, TARBP-B) discontinued
213163-01 50 µL

RPL3 (60S Ribosomal Protein L3, L3, ASC-1, TARBP-B) discontinued

Ask
View Details
RPL3 (60S Ribosomal Protein L3, L3, ASC-1, TARBP-B) discontinued
213163-02 100 µL

RPL3 (60S Ribosomal Protein L3, L3, ASC-1, TARBP-B) discontinued

Ask
View Details
RPL3 (60S Ribosomal Protein L3, L3, ASC-1, TARBP-B) discontinued
213163-03 200 µL

RPL3 (60S Ribosomal Protein L3, L3, ASC-1, TARBP-B) discontinued

Ask
View Details