Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mesothelin, Mouse (HEK293, His)

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Mesothelin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mesothelin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Molecular Formula

56047 (Gene_ID) Q61468 (D298-S600) (Accession)

Molecular Weight

38-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TAF3, CT (TAF3, Transcription initiation factor TFIID subunit 3, 140kD TATA box-binding protein-associated factor, TBP-associated factor 3, Transcription initiation factor TFIID 140kD subunit) (MaxLight 650)
MBS6353388-01 0.1 mL

TAF3, CT (TAF3, Transcription initiation factor TFIID subunit 3, 140kD TATA box-binding protein-associated factor, TBP-associated factor 3, Transcription initiation factor TFIID 140kD subunit) (MaxLight 650)

Ask
View Details
TAF3, CT (TAF3, Transcription initiation factor TFIID subunit 3, 140kD TATA box-binding protein-associated factor, TBP-associated factor 3, Transcription initiation factor TFIID 140kD subunit) (MaxLight 650)
MBS6353388-02 5x 0.1 mL

TAF3, CT (TAF3, Transcription initiation factor TFIID subunit 3, 140kD TATA box-binding protein-associated factor, TBP-associated factor 3, Transcription initiation factor TFIID 140kD subunit) (MaxLight 650)

Ask
View Details
CD95 Rabbit Polyclonal Antibody
E28PT0785 100 µL

CD95 Rabbit Polyclonal Antibody

Ask
View Details
HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 23 (FGF23)
MBS2046824-01 0.1 mL

HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 23 (FGF23)

Ask
View Details
HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 23 (FGF23)
MBS2046824-02 0.2 mL

HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 23 (FGF23)

Ask
View Details
HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 23 (FGF23)
MBS2046824-03 0.5 mL

HRP-Linked Polyclonal Antibody to Fibroblast Growth Factor 23 (FGF23)

Ask
View Details