Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Linear Semaglutide

Product Specifications

Synonyms

H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH; H-H (Aib) EGTFTSDVSSYLEGQAAKEFIAWLVRGRG-OH

Molecular Formula

C152H230N42O47

Molecular Weight

3,397.76 g/mol

Shipping Conditions

Cool Pack

Controlled

No

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Stxbp4 shRNA (UAS) - Lentiviral mouse Stxbp4 shRNA (UAS, RFP) (25)
GTR15301010 1 Vial

Lentiviral mouse Stxbp4 shRNA (UAS) - Lentiviral mouse Stxbp4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Glomeratose A
TBZ2133 20mg

Glomeratose A

Sign In for Pricing
View Details
Lentiviral human RAD50 shRNA (UAS) - Lentiviral human RAD50 shRNA (UAS, iRFP) plasmid
GTR15125368 1 Vial

Lentiviral human RAD50 shRNA (UAS) - Lentiviral human RAD50 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Ac-VEID-pNA, Colorimetric Substrate
440754-01 5 mg

Ac-VEID-pNA, Colorimetric Substrate

Sign In for Pricing
View Details
Ac-VEID-pNA, Colorimetric Substrate
440754-02 10 mg

Ac-VEID-pNA, Colorimetric Substrate

Sign In for Pricing
View Details
Lix1l (NM_001024303) Rat Tagged Lenti ORF Clone
RR207891L3 10 µg

Lix1l (NM_001024303) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details