Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active)

MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

May couple to the JAK1/2/3-STAT6 pathway and promote Th2 differentiation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.

Measured by its binding ability in a functional ELISA. Immobilized Human IL4 (CSB-MP011659HU) at 2 μg/mL can bind biotinylated Human IL4R. The EC50 is 12.68-14.23 ng/mL.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

"Human interleukin 4 receptor confers biological responsiveness and defines a novel receptor superfamily." Idzerda R.L., March C.J., Mosley B., Lyman S.D., Bos T.V., Gimpel S.D., Din W.S., Grabstein K.H., Widmer M.B., Beckmann M.P. J. Exp. Med. 171:861-873 (1990) "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Adams M.D. Genomics 60:295-308 (1999)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.