Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

5-TAMRA-Amyloid beta-Protein (1-40) trifluoroacetate salt

Product Specifications

CAS Number

1802087-81-5

Synonyms

5-TAMRA-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile- Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH; 5TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH

Molecular Formula

C219H315N55O62S

Molecular Weight

4,742.24 g/mol

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), CF405S conjugate, 0.1mg/mL
BNC040776-500 1x 500 µL

HER-2 / CD340 (ERB2/776), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF488A conjugate, 0.1mg/mL
BNC880918-100 1x 100 µL

CD44 Standard (HCAM/918), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details