Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Tyr0) -Stresscopin (human)

Product Specifications

CAS Number

1816939-43-1

Synonyms

H-Tyr-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn -Leu-Arg-Ala-Gln-Ala-Ala-A la-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD05665597

Molecular Formula

C204H335N57O55S2

Molecular Weight

4,530.33 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM220 Human Gene Knockout Kit (CRISPR)
KN423276 1 Kit

TMEM220 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Colorimetric Assay Kit
E-BC-K1105-M-01 48 T (32 samples)

Biotin Colorimetric Assay Kit

Sign In for Pricing
View Details
Biotin Colorimetric Assay Kit
E-BC-K1105-M-02 96 T (80 samples)

Biotin Colorimetric Assay Kit

Sign In for Pricing
View Details
Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Over-expression Lysate
LC423786 20 µg

Olfactory receptor 13C8 (OR13C8) (NM_001004483) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CSPG4 Recombinant Rabbit monoclonal Antibody
HA723245 100 µL

Human CSPG4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CPT1A Human Gene Knockout Kit (CRISPR)
KN200485 1 Kit

CPT1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details