Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Tyr0) -Stresscopin (human)

Product Specifications

CAS Number

1816939-43-1

Synonyms

H-Tyr-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn -Leu-Arg-Ala-Gln-Ala-Ala-A la-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD05665597

Molecular Formula

C204H335N57O55S2

Molecular Weight

4,530.33 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Blocking Buffer
643 1 L

ELISA Blocking Buffer

Sign In for Pricing
View Details
Recombinant Human MERTK/MER Protein (His Tag)
PKSH033481-01 10 µg

Recombinant Human MERTK/MER Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MERTK/MER Protein (His Tag)
PKSH033481-02 50 µg

Recombinant Human MERTK/MER Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat TNF-alpha/TNFA Protein
PKSR030443 20 µg

Recombinant Rat TNF-alpha/TNFA Protein

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF740 conjugate, 0.1mg/mL
BNC742867-100 1x 100 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF600 Antibody
8C19604-AAT 50 µg

ZNF600 Antibody

Sign In for Pricing
View Details