Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Tyr0) -Stresscopin (human)

Product Specifications

CAS Number

1816939-43-1

Synonyms

H-Tyr-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn -Leu-Arg-Ala-Gln-Ala-Ala-A la-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD05665597

Molecular Formula

C204H335N57O55S2

Molecular Weight

4,530.33 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Netrin 1 (Ntn1) ELISA Kit
RDR-Ntn1-Hu-01 96 Tests

Human Netrin 1 (Ntn1) ELISA Kit

Sign In for Pricing
View Details
Human Netrin 1 (Ntn1) ELISA Kit
RDR-Ntn1-Hu-02 48 Tests

Human Netrin 1 (Ntn1) ELISA Kit

Sign In for Pricing
View Details
ZADH1 (PTGR2) (NM_001146155) Human Over-expression Lysate
LY431867 100 µg

ZADH1 (PTGR2) (NM_001146155) Human Over-expression Lysate

Sign In for Pricing
View Details
Tas2r103 Mouse Gene Knockout Kit (CRISPR)
KN517190 1 Kit

Tas2r103 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GALK2 Rabbit Polyclonal Antibody
TA376464 100 µL

GALK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842I-01 20 Tests

PE/Cyanine5.5 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details