Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Tyr0) -Stresscopin (human)

Product Specifications

CAS Number

1816939-43-1

Synonyms

H-Tyr-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn -Leu-Arg-Ala-Gln-Ala-Ala-A la-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-YTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD05665597

Molecular Formula

C204H335N57O55S2

Molecular Weight

4,530.33 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA4 Human Gene Knockout Kit (CRISPR)
KN204482BN 1 Kit

MAGEA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADCY4 (Center) Rabbit Polyclonal Antibody
AP50087PU-N 400 µL

ADCY4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500147 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human High Mobility Group AT Hook Protein 2 (HMGA2) ELISA Kit
RD-HMGA2-Hu-01 96 Tests

Human High Mobility Group AT Hook Protein 2 (HMGA2) ELISA Kit

Sign In for Pricing
View Details
Human High Mobility Group AT Hook Protein 2 (HMGA2) ELISA Kit
RD-HMGA2-Hu-02 48 Tests

Human High Mobility Group AT Hook Protein 2 (HMGA2) ELISA Kit

Sign In for Pricing
View Details
2610524H06Rik (NM_181075) Mouse Tagged ORF Clone
MG200868 10 µg

2610524H06Rik (NM_181075) Mouse Tagged ORF Clone

Sign In for Pricing
View Details