Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Tyr0) -Urocortin (rat)

Product Specifications

CAS Number

187111-93-9

Synonyms

H-Tyr-Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln -Arg-Glu-Arg-Ala-Glu-G ln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2; H-YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2

MDL Number

MFCD00678221

Molecular Formula

C215H347N63O66

Molecular Weight

4,870.44 g/mol

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2AK1 Human Gene Knockout Kit (CRISPR)
KN200065RB 1 Kit

EIF2AK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde
TRC-B661575-5MG 5 mg

N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-01 20 µg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-02 100 µg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-03 500 µg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-04 1 mg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details