Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Tyr0) -Urocortin (rat)

Product Specifications

CAS Number

187111-93-9

Synonyms

H-Tyr-Asp-Asp-Pro-Pro-Leu-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Thr-Leu-Leu-Glu-Leu-Ala-Arg-Thr-Gln-Ser-Gln -Arg-Glu-Arg-Ala-Glu-G ln-Asn-Arg-Ile-Ile-Phe-Asp-Ser-Val-NH2; H-YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2

MDL Number

MFCD00678221

Molecular Formula

C215H347N63O66

Molecular Weight

4,870.44 g/mol

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC91 activation kit by CRISPRa
GA110684 1 Kit

Human CCDC91 activation kit by CRISPRa

Sign In for Pricing
View Details
TOM1 (NM_001135730) Human Recombinant Protein
TP327190 20 µg

TOM1 (NM_001135730) Human Recombinant Protein

Sign In for Pricing
View Details
1-O-Levulinoyl Resveratrol Diacetate
TRC-L379700-10MG 10 mg

1-O-Levulinoyl Resveratrol Diacetate

Sign In for Pricing
View Details
ASH2L Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF810988 100 µg

ASH2L Mouse Monoclonal Antibody [Clone ID: OTI2H3]

Sign In for Pricing
View Details
H2BC18 (NM_001024599) Human Over-expression Lysate
LY422516 100 µg

H2BC18 (NM_001024599) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC2 (Mucin 2) (rMLP/842), CF640R conjugate, 0.1mg/mL
BNC403609-100 1x 100 µL

MUC2 (Mucin 2) (rMLP/842), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details