Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIP-39 trifluoroacetate salt

Product Specifications

CAS Number

277302-47-3

Synonyms

H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Le u-Leu-Val-Leu-Asp-Ala-Pro-OH; H-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-OH

Smiles

CC (C) CC (C (=O) NC (C) C (=O) NC (CC (=O) O) C (=O) NC (CC (=O) O) C (=O) NC (C) C (=O) NC (C) C (=O) NC (CC1=CC=CC=C1) C (=O) NC (CCCNC (=N) N) C (=O) NC (CCC (=O) O) C (=O) NC (CCCNC (=N) N) C (=O) NC (C) C (=O) NC (CCCNC (=N) N) C (=O) NC (CC (C) C) C (=O) NC (CC (C) C) C (=O) NC (C) C (=O) NC (C) C (=O) NC (CC (C) C) C (=O) NC (CCC (=O) O) C (=O) NC (CCCNC (=N) N) C (=O) NC (CCCNC (=N) N) C (=O) NC (CC2=CN=CN2) C (=O) NC (CC3=CNC4=CC=CC=C43) C (=O) NC (CC (C) C) C (=O) NC (CC (=O) N) C (=O) NC (CO) C (=O) NC (CC5=CC=C (C=C5) O) C (=O) NC (CCSC) C (=O) NC (CC6=CN=CN6) C (=O) NC (CCCCN) C (=O) NC (CC (C) C) C (=O) NC (CC (C) C) C (=O) NC (C (C) C) C (=O) NC (CC (C) C) C (=O) NC (CC (=O) O) C (=O) NC (C) C (=O) N7CCCC7C (=O) O) NC (=O) C (C) NC (=O) C (CC (C) C) NC (=O) C (CO) N

Molecular Formula

C202H325N61O54S

Molecular Weight

4,504.19 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf31 Mouse Gene Knockout Kit (CRISPR)
KN314948LP 1 Kit

Rnf31 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Depdc5 Mouse Gene Knockout Kit (CRISPR)
KN304504BN 1 Kit

Depdc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAI2 (ADGRB2) Human Gene Knockout Kit (CRISPR)
KN424664 1 Kit

BAI2 (ADGRB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lysozyme Recombinant Rabbit monoclonal Antibody [ST50-02]
ET1609-35-50UL 50 µL

Lysozyme Recombinant Rabbit monoclonal Antibody [ST50-02]

Sign In for Pricing
View Details
Cytochrome b reductase 1 (CYBRD1) (NM_001127383) Human Over-expression Lysate
LY426766 100 µg

Cytochrome b reductase 1 (CYBRD1) (NM_001127383) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human STAT5B Protein (His Tag)
PKSH033058-01 10 µg

Recombinant Human STAT5B Protein (His Tag)

Sign In for Pricing
View Details