Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stresscopin (human)

Product Specifications

CAS Number

352020-03-2

Synonyms

H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-As n-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD03458628

Smiles

C1cc (c (cc1F) c2ccn[nH]2) C3Cc4nccn4C3

Molecular Formula

C195H326N56O53S2

Molecular Weight

4,367.15 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGN2P37 Protein Vector (Human) (pPM-C-His)
PV083940 500 ng

HMGN2P37 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)
MBS6412418-01 0.1 mL

CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)

Sign In for Pricing
View Details
CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)
MBS6412418-02 5x 0.1 mL

CREB, Phosphorylated (Ser133) (CREB1, cAMP Response Element Binding Protein, MGC9284) (Biotin)

Sign In for Pricing
View Details
Anti-Phospho-MAP3K7IP1 (Ser423) Polyclonal Antibody
TMAB-10930-01 50 μL

Anti-Phospho-MAP3K7IP1 (Ser423) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-MAP3K7IP1 (Ser423) Polyclonal Antibody
TMAB-10930-02 100 µL

Anti-Phospho-MAP3K7IP1 (Ser423) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-MAP3K7IP1 (Ser423) Polyclonal Antibody
TMAB-10930-03 200 µL

Anti-Phospho-MAP3K7IP1 (Ser423) Polyclonal Antibody

Sign In for Pricing
View Details