Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stresscopin (human)

Product Specifications

CAS Number

352020-03-2

Synonyms

H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-As n-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD03458628

Smiles

C1cc (c (cc1F) c2ccn[nH]2) C3Cc4nccn4C3

Molecular Formula

C195H326N56O53S2

Molecular Weight

4,367.15 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPE Antibody - N-terminal region : HRP (ARP56726_P050-HRP)
ARP56726_P050-HRP 100 µL

RPE Antibody - N-terminal region : HRP (ARP56726_P050-HRP)

Sign In for Pricing
View Details
Tau
336631 100 µL

Tau

Sign In for Pricing
View Details
DDX19B discontinued
388228 200 µL

DDX19B discontinued

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1031683-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1031683-02 0.02 mg (Yeast)

Recombinant Haemophilus influenzae DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1031683-03 0.1 mg (E-Coli)

Recombinant Haemophilus influenzae DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details