What is the catalog number for Stresscopin (human)?

The catalog number for Stresscopin (human) is FS109538.

What sizes are available for Stresscopin (human)?

Stresscopin (human) is available in the following size(s): 250 µg, 500 µg, 1000 µg.

How many pack sizes does Stresscopin (human) come in?

Stresscopin (human) is available in 3 different pack sizes.

Is Stresscopin (human) in stock?

Stresscopin (human) is currently made to order / not held in immediate stock. Contact us for lead time.

Stresscopin (human)

Product Specifications

CAS Number

352020-03-2

Synonyms

H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-As n-Ala-His-Leu-Met-Ala-Gln-Ile-NH2; H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

MDL Number

MFCD03458628

Smiles

C1cc (c (cc1F) c2ccn[nH]2) C3Cc4nccn4C3

Molecular Formula

C195H326N56O53S2

Molecular Weight

4,367.15 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MR201824 10 µg

Vsnl1 (NM_012038) Mouse Tagged ORF Clone

Sign In for Pricing

View Details

PV192444 500 ng

ISLR2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details

282595-01 50 mg

Methyl-4,4-dimethoxy-2- (3-nitrobenzylidene) -acetoacetate

Sign In for Pricing

View Details

282595-02 100 mg

Methyl-4,4-dimethoxy-2- (3-nitrobenzylidene) -acetoacetate

Sign In for Pricing

View Details

282595-03 250 mg

Methyl-4,4-dimethoxy-2- (3-nitrobenzylidene) -acetoacetate

Sign In for Pricing

View Details

282595-04 500 mg

Methyl-4,4-dimethoxy-2- (3-nitrobenzylidene) -acetoacetate

Sign In for Pricing

View Details