Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) TFA salt

Product Specifications

CAS Number

96081-16-2 (free base)

Synonyms

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

C321H499N93O101S6 (freebase)

Molecular Weight

7,469.36 g/mol

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPV5 Rabbit mAb
E38A4077 100 µg -100 µL

TRPV5 Rabbit mAb

Sign In for Pricing
View Details
ACTR8 Antibody (Biotin)
orb353800-01 50 µg

ACTR8 Antibody (Biotin)

Sign In for Pricing
View Details
ACTR8 Antibody (Biotin)
orb353800-02 100 µg

ACTR8 Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein YIPF3 (yipf3), partial
MBS7078841 Inquire

Recombinant Xenopus laevis Protein YIPF3 (yipf3), partial

Sign In for Pricing
View Details
Rabbit Thrombomodulin (TM) ELISA Kit
DLR-TM-Rb-01 48 Tests

Rabbit Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
Rabbit Thrombomodulin (TM) ELISA Kit
DLR-TM-Rb-02 96 Tests

Rabbit Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details