Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rec IGF-II (1-67) TFA salt

Product Specifications

CAS Number

96081-16-2 (free base)

Synonyms

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

C321H499N93O101S6 (freebase)

Molecular Weight

7,469.36 g/mol

Controlled

No

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA9 Rabbit pAb, Pacific Blue conjugated
orb2871101 100 µL

NDUFA9 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
rac Naproxen-d3
TRC-N377527-1MG 1 mg

rac Naproxen-d3

Sign In for Pricing
View Details
RPS28P4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784893 1.0 µg DNA

RPS28P4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RETNLB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1809808 1.0 µg DNA

RETNLB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CD80 Antibody
orb1337419 100 µg

CD80 Antibody

Sign In for Pricing
View Details
A1BG (NM_130786) Human Tagged ORF Clone Lentiviral Particle
RC221406L3V 200 µL

A1BG (NM_130786) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details