Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-37) (human) trifluoroacetate salt

Product Specifications

CAS Number

136799-54-7

Synonyms

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-As n-Phe-Val-Ala-Leu-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL-OH

MDL Number

MFCD00243099

Molecular Formula

C195H316N58O54S2

Molecular Weight

4,401.09 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR3 Rabbit Polyclonal Antibody
AP18025PU-N 400 µL

FPR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM177 (NM_001105199) Human Over-expression Lysate
LC426223 20 µg

TMEM177 (NM_001105199) Human Over-expression Lysate

Sign In for Pricing
View Details
Disp3 Mouse Gene Knockout Kit (CRISPR)
KN514157 1 Kit

Disp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PBP (PEBP1) Human Gene Knockout Kit (CRISPR)
KN206355 1 Kit

PBP (PEBP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TRIM17 activation kit by CRISPRa
GA109589 1 Kit

Human TRIM17 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Angiogenin Recombinant Rabbit monoclonal Antibody
HA725077 100 µL

Human Angiogenin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details