Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-37) (human) trifluoroacetate salt

Product Specifications

CAS Number

136799-54-7

Synonyms

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-As n-Phe-Val-Ala-Leu-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL-OH

MDL Number

MFCD00243099

Molecular Formula

C195H316N58O54S2

Molecular Weight

4,401.09 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)
KN418041 1 Kit

Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF568 conjugate, 0.1mg/mL
BNC681176-100 1x 100 µL

EMI1 (EMI1/1176), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ECI2 Antibody
KC-947-01 50 μL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-947-02 100 µL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-947-03 1 mL

ECI2 Antibody

Sign In for Pricing
View Details
CD45 Recombinant Rabbit monoclonal Antibody
HA723506 100 µL

CD45 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details