Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-37) (human) trifluoroacetate salt

Product Specifications

CAS Number

136799-54-7

Synonyms

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-As n-Phe-Val-Ala-Leu-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL-OH

MDL Number

MFCD00243099

Molecular Formula

C195H316N58O54S2

Molecular Weight

4,401.09 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometrium
CS509003 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) (NM_002257) Human Recombinant Protein
TP720400L 500 µg

Kallikrein 1 (KLK1) (NM_002257) Human Recombinant Protein

Sign In for Pricing
View Details
Protein C (PROC) Rabbit Polyclonal Antibody
AP11023PU-N 400 µL

Protein C (PROC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRTAP25-1 Human Gene Knockout Kit (CRISPR)
KN425022 1 Kit

KRTAP25-1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MBNL3 (NM_018388) Human Recombinant Protein
TP316043M 100 µg

MBNL3 (NM_018388) Human Recombinant Protein

Sign In for Pricing
View Details
FGFR2 (NM_000141) Human Recombinant Protein
TP762751 50 µg

FGFR2 (NM_000141) Human Recombinant Protein

Sign In for Pricing
View Details