Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-38) (human)

Product Specifications

CAS Number

78232-94-7

Synonyms

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu -Gln-Asp-Val-His-A sn-Phe-Val-Ala-Leu-Gly-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH

MDL Number

MFCD00147826

Molecular Formula

C197H319N59O55S2

Molecular Weight

4,458.14 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF22 (NM_173588) Human Tagged Lenti ORF Clone
RC215077L4 10 µg

IGSF22 (NM_173588) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human B-type Natriuretic Protein
7-00218 25 mg

Human B-type Natriuretic Protein

Sign In for Pricing
View Details
NSMCE1 (non-SMC Element 1 Homolog (S. cerevisiae), NSE1)
249506 50 µg

NSMCE1 (non-SMC Element 1 Homolog (S. cerevisiae), NSE1)

Sign In for Pricing
View Details
ZNF764 antibody
70R-9588 100 µL

ZNF764 antibody

Sign In for Pricing
View Details
T7 tag Mouse mAb, PE-Cy7 conjugated
orb970537 100 µL

T7 tag Mouse mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Anti-PARVB Rabbit pAb
GB114536 100 μL

Anti-PARVB Rabbit pAb

Sign In for Pricing
View Details