PTH (1-38) (human)
Product Specifications
CAS Number
78232-94-7
Synonyms
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu -Gln-Asp-Val-His-A sn-Phe-Val-Ala-Leu-Gly-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH
MDL Number
MFCD00147826
Molecular Formula
C197H319N59O55S2
Molecular Weight
4,458.14 g/mol
Controlled
No
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2148881-01 0.1 mL
PE-Linked Polyclonal Antibody to Purinergic Receptor P2X, Ligand Gated Ion Channel 6 (P2RX6)
Sign In for Pricing
View Details MBS2148881-02 0.2 mL
PE-Linked Polyclonal Antibody to Purinergic Receptor P2X, Ligand Gated Ion Channel 6 (P2RX6)
Sign In for Pricing
View Details MBS2148881-03 0.5 mL
PE-Linked Polyclonal Antibody to Purinergic Receptor P2X, Ligand Gated Ion Channel 6 (P2RX6)
Sign In for Pricing
View Details MBS2148881-04 1 mL
PE-Linked Polyclonal Antibody to Purinergic Receptor P2X, Ligand Gated Ion Channel 6 (P2RX6)
Sign In for Pricing
View Details MBS2148881-05 5 mL
PE-Linked Polyclonal Antibody to Purinergic Receptor P2X, Ligand Gated Ion Channel 6 (P2RX6)
Sign In for Pricing
View Details