Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-38) (human)

Product Specifications

CAS Number

78232-94-7

Synonyms

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu -Gln-Asp-Val-His-A sn-Phe-Val-Ala-Leu-Gly-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH

MDL Number

MFCD00147826

Molecular Formula

C197H319N59O55S2

Molecular Weight

4,458.14 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFS Overexpression Lysate (Native) - (Dry Ice)
NBL1-10148 0.1 mg

EFS Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
2- (ethoxycarbonyl) -1H-indole-5-carboxylic acid
sc-340272A 5 g

2- (ethoxycarbonyl) -1H-indole-5-carboxylic acid

Sign In for Pricing
View Details
RIMKLB (NM_001297776) Human Tagged ORF Clone
RC237893 10 µg

RIMKLB (NM_001297776) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ttc9 AAV siRNA Pooled Vector
48710166 1.0 µg

Ttc9 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ACSL4 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-13129R-BF647 100 µL

ACSL4 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
3-{[ (5-Bromofuran-2-yl) methyl]amino}-4-methylbenzoic acid
HWB94503-01 50 mg

3-{[ (5-Bromofuran-2-yl) methyl]amino}-4-methylbenzoic acid

Sign In for Pricing
View Details