What is the catalog number for PTH (1-38) (human)?

The catalog number for PTH (1-38) (human) is FP109373.

What sizes are available for PTH (1-38) (human)?

PTH (1-38) (human) is available in the following size(s): 500 µg, 1000 µg, 2000 µg.

How many pack sizes does PTH (1-38) (human) come in?

PTH (1-38) (human) is available in 3 different pack sizes.

Is PTH (1-38) (human) in stock?

PTH (1-38) (human) is currently made to order / not held in immediate stock. Contact us for lead time.

PTH (1-38) (human)

Product Specifications

CAS Number

78232-94-7

Synonyms

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu -Gln-Asp-Val-His-A sn-Phe-Val-Ala-Leu-Gly-OH; H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH

MDL Number

MFCD00147826

Molecular Formula

C197H319N59O55S2

Molecular Weight

4,458.14 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-482225 1 g

6-Bromo-2,3-difluorobenzoic acid

Sign In for Pricing

View Details

NBP2-70856G 0.1 mL

Mouse Monoclonal GSTA4 Antibody (OTI3F5) [DyLight 488]

Sign In for Pricing

View Details

028795 96 Tests

V-Fos FBJ Mouse Osteosarcoma Viral Oncogene Homolog (FOS) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing

View Details

sc-165985 AF790 200 µg/mL

XRN1 (C-1) Alexa Fluor® 790

Sign In for Pricing

View Details

45529086 1.0 µg

Ss18l1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing

View Details

MBS2040578-01 0.1 mL

FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)

Sign In for Pricing

View Details