Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (2-38) (human) acetate salt

Product Specifications

CAS Number

154765-04-5

Synonyms

H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Ph e-Val-Ala-Leu-Gly-OH; H-VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH

Molecular Formula

C194H314N58O53S2

Molecular Weight

4,371.06 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r48 Mouse Gene Knockout Kit (CRISPR)
KN519177 1 Kit

Vmn2r48 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GUCY2D (Center) Rabbit Polyclonal Antibody
AP51984PU-N 400 µL

GUCY2D (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CT47A6 (NM_001080141) Human Over-expression Lysate
LY421597 100 µg

CT47A6 (NM_001080141) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR562490 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF594 conjugate, 0.1mg/mL
BNC942452-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexadecyl Bromoacetate-13C2
TRC-H293722-50MG 50 mg

Hexadecyl Bromoacetate-13C2

Sign In for Pricing
View Details