Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (2-38) (human) acetate salt

Product Specifications

CAS Number

154765-04-5

Synonyms

H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Ph e-Val-Ala-Leu-Gly-OH; H-VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH

Molecular Formula

C194H314N58O53S2

Molecular Weight

4,371.06 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-2019-nCoV S-IgA Neutralizing Antibody
E-AB-V1027-01 50 µL

Anti-2019-nCoV S-IgA Neutralizing Antibody

Sign In for Pricing
View Details
Anti-2019-nCoV S-IgA Neutralizing Antibody
E-AB-V1027-02 100 µL

Anti-2019-nCoV S-IgA Neutralizing Antibody

Sign In for Pricing
View Details
Anti-2019-nCoV S-IgA Neutralizing Antibody
E-AB-V1027-03 200 µL

Anti-2019-nCoV S-IgA Neutralizing Antibody

Sign In for Pricing
View Details
(4-Sulfamoylphenyl)hydrazine Hydrochloride
TRC-S699078-1G 1 g

(4-Sulfamoylphenyl)hydrazine Hydrochloride

Sign In for Pricing
View Details
4',5'-Bis(1,3,2-dithiarsolan-2-yl)-3',6'-dihydroxy-3-oxospiro[isobenzofuran-1(3H),9'-[9H]xanthene]-6-carboxylic Acid
TRC-B431950-5MG 5 mg

4',5'-Bis(1,3,2-dithiarsolan-2-yl)-3',6'-dihydroxy-3-oxospiro[isobenzofuran-1(3H),9'-[9H]xanthene]-6-carboxylic Acid

Sign In for Pricing
View Details
Troponin C1 (TNNC1) (NM_003280) Human Recombinant Protein
TP710218 20 µg

Troponin C1 (TNNC1) (NM_003280) Human Recombinant Protein

Sign In for Pricing
View Details