Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (2-38) (human) acetate salt

Product Specifications

CAS Number

154765-04-5

Synonyms

H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Ph e-Val-Ala-Leu-Gly-OH; H-VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG-OH

Molecular Formula

C194H314N58O53S2

Molecular Weight

4,371.06 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAHD2A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D4]
TA500936AM 100 µL

FAHD2A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D4]

Sign In for Pricing
View Details
Human Aquaporin 0 (MIP) activation kit by CRISPRa
GA102911 1 Kit

Human Aquaporin 0 (MIP) activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Rabbit Polyclonal Antibody to Bovine IgG
FA-2351-2 2 mL

FITC Conjugated Rabbit Polyclonal Antibody to Bovine IgG

Sign In for Pricing
View Details
Milk Analyzer BANA-700
BANA-700 1 Unit

Milk Analyzer BANA-700

Sign In for Pricing
View Details
DL-Menthyl Palmitate
TRC-M101420-1G 1 g

DL-Menthyl Palmitate

Sign In for Pricing
View Details
Mouse Bmp4 activation kit by CRISPRa
GA200419 1 Kit

Mouse Bmp4 activation kit by CRISPRa

Sign In for Pricing
View Details