Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Nle 35) -Amyloid b-Protein (1-42) ammonium salt

Product Specifications

CAS Number

1802086-51-6

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Nle-Val-Gly-Gly-Val-Val-Ile-Ala-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL (Nle) VGGVVIA-OH

Molecular Formula

C204H313N55O60

Molecular Weight

4,496 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-100 1x 100 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF740 conjugate, 0.1mg/mL
BNC742946-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF640R conjugate, 0.1mg/mL
BNC402829-100 1x 100 µL

Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF488A conjugate, 0.1mg/mL
BNC880421-500 1x 500 µL

Neurofilament (NF-H) (NF421), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF647 conjugate, 0.1mg/mL
BNC472340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details