Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP IL-1 beta, Human

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. GMP IL-1 beta Protein, Human, is a recombinant GMP-grade protein, consists of 153 amino acids (A117-S269) and is expressed in E. coli.

Product Specifications

Product Name Alternative

GMP IL-1 beta Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-il-1-beta-protein-human.html

Purity

98.0

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122 (10) :3476-89.|[2]Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399 (4) :542-7.|[3]Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6 (6) :e21477.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM5-set siRNA/shRNA/RNAi Lentivector (Human)
47798091 4x 500 ng

TRIM5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Isavuconazole Impurity 117
RM-I192317-01 10 mg

Isavuconazole Impurity 117

Sign In for Pricing
View Details
Isavuconazole Impurity 117
RM-I192317-02 25 mg

Isavuconazole Impurity 117

Sign In for Pricing
View Details
Isavuconazole Impurity 117
RM-I192317-03 50 mg

Isavuconazole Impurity 117

Sign In for Pricing
View Details
Isavuconazole Impurity 117
RM-I192317-04 100 mg

Isavuconazole Impurity 117

Sign In for Pricing
View Details
PDK1 antibody
70R-11834 100 ug

PDK1 antibody

Sign In for Pricing
View Details