Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Met (O) 35) -Amyloid b-Protein (1-42)

Product Specifications

CAS Number

1802086-68-5

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met (O) -Val-Gly-Gly-Val-Val-Ile-Ala-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL (MetO) VGGVVIA-OH

MDL Number

MFCD08460563

Molecular Formula

C203H311N55O61S

Molecular Weight

4,530.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP7 Antibody (Biotin)
KB-7375-01 50 μL

ENPP7 Antibody (Biotin)

Sign In for Pricing
View Details
ENPP7 Antibody (Biotin)
KB-7375-02 100 µL

ENPP7 Antibody (Biotin)

Sign In for Pricing
View Details
ENPP7 Antibody (Biotin)
KB-7375-03 1 mL

ENPP7 Antibody (Biotin)

Sign In for Pricing
View Details
MAGEF1 (NM_022149) Human Recombinant Protein
TP304018L 1 mg

MAGEF1 (NM_022149) Human Recombinant Protein

Sign In for Pricing
View Details
Msi2 Mouse Gene Knockout Kit (CRISPR)
KN310426RB 1 Kit

Msi2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human REG4/RELP Protein (Fc Tag)
PKSH031222 100 µg

Recombinant Human REG4/RELP Protein (Fc Tag)

Sign In for Pricing
View Details