Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Met (O) 35) -Amyloid b-Protein (1-42)

Product Specifications

CAS Number

1802086-68-5

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met (O) -Val-Gly-Gly-Val-Val-Ile-Ala-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL (MetO) VGGVVIA-OH

MDL Number

MFCD08460563

Molecular Formula

C203H311N55O61S

Molecular Weight

4,530.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp277 Mouse Gene Knockout Kit (CRISPR)
KN519768 1 Kit

Zfp277 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDC25C Rabbit Polyclonal Antibody
AP02408PU-S 50 µL

CDC25C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adamts7 Mouse Gene Knockout Kit (CRISPR)
KN500864 1 Kit

Adamts7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Samd12 Mouse Gene Knockout Kit (CRISPR)
KN515272 1 Kit

Samd12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSPA14 Human Gene Knockout Kit (CRISPR)
KN418858 1 Kit

HSPA14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(9S,12R,13S)-Pinellic Acid
TRC-P102735-5MG 5 mg

(9S,12R,13S)-Pinellic Acid

Sign In for Pricing
View Details