Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Met (O) 35) -Amyloid b-Protein (1-42)

Product Specifications

CAS Number

1802086-68-5

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met (O) -Val-Gly-Gly-Val-Val-Ile-Ala-OH; H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL (MetO) VGGVVIA-OH

MDL Number

MFCD08460563

Molecular Formula

C203H311N55O61S

Molecular Weight

4,530.04 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Protein Jumonji Antibody
RC-4927-01 50 μL

Recombinant Protein Jumonji Antibody

Sign In for Pricing
View Details
Recombinant Protein Jumonji Antibody
RC-4927-02 100 µL

Recombinant Protein Jumonji Antibody

Sign In for Pricing
View Details
Recombinant Protein Jumonji Antibody
RC-4927-03 1 mL

Recombinant Protein Jumonji Antibody

Sign In for Pricing
View Details
DNMT1 Human Gene Knockout Kit (CRISPR)
KN217851LP 1 Kit

DNMT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITS3-ITS4 Library Preparation Kit for Illumina (Set D)
71140 96 Preparations

ITS3-ITS4 Library Preparation Kit for Illumina (Set D)

Sign In for Pricing
View Details
C-Kit Polyclonal Antibody
E-AB-70350-01 60 µL

C-Kit Polyclonal Antibody

Sign In for Pricing
View Details