Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(Lys22) -Amyloid b-Protein (1-40) trifluoroacetate salt

Product Specifications

CAS Number

302905-01-7

Synonyms

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe -Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH; H-DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV-OH

Smiles

COC1=CC=C (C=C1) C2=CSC (=N2) N3CCN (CC3) C (=O) C4=CC=CC=C4

Molecular Formula

C195H300N54O56S

Molecular Weight

4,328.86 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-500 1x 500 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details